PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013586198.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GATA
Protein Properties Length: 288aa    MW: 32223.1 Da    PI: 9.181
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013586198.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA64.21.5e-20214248135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C ttkTp+WR+gp+g+ktLCnaCG+++r+ +l
  XP_013586198.1 214 CTHCETTKTPQWREGPNGPKTLCNACGVRFRSGRL 248
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.09E-15207270No hitNo description
SMARTSM004013.8E-20208258IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.084212244IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.9E-15212245IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.70E-17213262No hitNo description
PfamPF003202.4E-18214248IPR000679Zinc finger, GATA-type
PROSITE patternPS003440214239IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MNWLPEEEFK GLSDNFFDDF INHIDFPLED IDTTNGEGGD WDAKFKELEP PPMDMFTTFP  60
SELNSCGVAS KAGIKKNVSV LKQSDASAAL SGINDTLNQS SSHPDVKVSK LFQSSSPVSV  120
LESSDGSFSP PNSTSLRLTF PVKGLRSKRK RPTTLRRRHL YPFEPEKLTP GESKSETYYS  180
YEKHAKKKRK IFTTNHTVSS SSEAIDSDGV VRRCTHCETT KTPQWREGPN GPKTLCNACG  240
VRFRSGRLVP EYRPASSPTF IPSVHSNSHR KIIEMRSREG DQFGKRAV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013586198.10.0PREDICTED: GATA transcription factor 11-like isoform X1
RefseqXP_013586199.10.0PREDICTED: GATA transcription factor 11-like isoform X1
SwissprotQ6DBP81e-139GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A0D3C8E90.0A0A0D3C8E9_BRAOL; Uncharacterized protein
STRINGBra018665.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-121GATA transcription factor 11